logo





circRNA ID
AT1G01320_circ_g.7
Alias
ath_circ_000041, At_ciR365
Organism
Arabidpsis thaliana
Position
chr1: 123579-124123  JBrowse»
Reference genome
TAIR10.38
Type  
e-circRNA
Identification method
CIRCexplorer, PcircRNA_finder, find_circ, CIRI-full
Parent gene
Parent gene annotation
Tetratricopeptide repeat (TPR)-like superfamily protein
Parent gene strand
-
Splice junction sequence  
CTCGAAGGATTCTTAAGGTTGTTTGCTCATGCTGAACACTTAAATGGTATGCCTCCATCAAGGA
GAGCGCAATTGCTATGGCATGGTAGCTTGCAGCAGTcttcagaatatagttcttcctctttgct
gccacgctctctttgccttttgcgttatgacttgggttgatatagtcgagtagatcggaaacac
tgcaaaac
Support reads
10/9/2
Tissues
leaf/whole_plant/seedlings
Exon boundary  
Yes-Yes
Splicing signals  
CT-AC
Sanger sequencing for BSS  
NA
PCR primers for BSS  
NA
Assembled circRNA sequence  
CTTCAGAATATAGTTCTTCCTCTTTGCTGCCACGCTCTCTTTGCCTTTTGCGTTATGACTTGGG
TTGATATAGTCGAGTAGATCGGAAACACTTAGGTGGCCTTTGCTGGCTATAGACGCGTCTGGCT
TAGGAGTACCATTTCGCGCAGCTTCTTGTTGTTCAAAAGCCTTGGACTCAAAGTATTCTAGCCA
AGCAGCAGCATCCTGAGTACGTAAATCATCTGGCCCCAGCTTTGCTCGAAGGATTCTTAAGGTT
GTTTGCTCATGCTGAACACTTAAATGGTATGCCTCCATCAAGGAGAGCGCAATTGCTATGGCAT
GGTAGCTTGCAGCAGTCTTCAGAATATAGTTCTTCCTCTTTGCTGCCACGCTCTCTTTGCCTTT
TGCGTTATGACTTGGGTTGATATAGTCGAGTAGATCGGAAACACTTAGGTGGCCTTTGCTGGCT
ATAGACGCGTCTGGCTTAGGAGTACCATTTCGCGCAGCTTCTTGTTGTTCAAAAGCCTTGGACT
CAAAGTATTCTAGCCAAGCAGCAGCATCCTGAGTACGTAAATCATCTGGCCCCAGCTTTGCTCG
AAGGATTCTTAAGGTTGTTTGCTCATGCTGAACACTTAAATGGTATGCCTCCATCAAGGAGAGC
GCAATTGCTATGGCATGGTAGCTTGCAGCAGT
Sanger sequencing for FL  
NA
PCR primers for FL  
NA
Genomic sequence
CTTCAGAATATAGTTCTTCCTCTTTGCTGCCACGCTCTCTTTGCCTTTTGCGTTATGACTTGGG
TTGATATAGTCGAGTAGATCGGAAACACTGCAAAACATTATCAACTTAAGGATCTGGCCAAGGA
GTACACTTAATTGACACATTCAAACAAAATAAAAAACTTATAAACAACAAATAAGGAGATATCA
GAAAGTTGTTTGACCTTAGGTGGCCTTTGCTGGCTATAGACGCGTCTGGCTTAGGAGTACCATT
TCGCGCAGCTTCTTGTTGTTCAAAAGCCTTGGACTCAAAGTATTCTAGCCAAGCAGCAGCATCC
TGAACCATATAATCAATTGTCAAACTTAAAGAATGCATACAGTTGTCAGAAAGATGACTAATTT
GGCTGATAGGATATCATGATAATATATACCTGAGTACGTAAATCATCTGGCCCCAGCTTTGCTC
GAAGGATTCTTAAGGTTGTTTGCTCATGCTGAACACTTAAATGGTATGCCTCCATCAAGGAGAG
CGCAATTGCTATGGCATGGTAGCTTGCAGCAGT
Number of exons covered
AT1G01320.1:3
AT1G01320.2:3
AT1G01320.3:3
Conserved circRNAs
NA
Coding potential
Y
Potential coding position
124082-123581(-)
Potential amino acid sequence
MEAYHLSVQHEQTTLRILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAARNGTPKPDASIASK
GHLSVSDLLDYINPSHNAKGKESVAAKRKNYILKTAASYHAIAIALSLMEAYHLSVQHEQTTLR
ILRAKLGPDDLRTQDAAAWLEYFESKAFEQQEAARNGTPKPDASIASKGHLSVSDLLDYINPSH
NAKGKESVAAKRKNYILKTAASYHAIAIALSLMEAYHLSVQHEQTTLRILRAKLGPDDLRTQDA
AAWLEYFESKAFEQQEAARNGTPKPDASIASKGHLSVSDLLDYINPSHNAKGKESVAAKRKNYI
LKTAASYHAIAIALSLMEAYHLSVQHEQTTLRILRAKLGPDDLRTQDAAAWLEYFESKAFEQQE
AARNGTPKPDASIASKGHLSVSDLLDYINPSHNAKGKESVAAKRKNYILK(-)
Sponge-miRNAs
NA
circRNA-miRNA-mRNA network
References
Ye et al., 2015;Chu et al., 2017;Pan et al., 2017

Copyright©2017-2021 Institute of Crop Sciences / Institute of Bioinformatics, Zhejiang University.
Any questions or suggestions, please contact the Fan's lab, bioinplant@zju.edu.cn
For submittion, please click here. Last modified at 2021-03-09.

Supported by   nsfc    zju