Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0521700_circ_g.1 |
| ID in PlantcircBase | osa_circ_007715 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 20197242-20198354 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0521700 |
| Parent gene annotation |
Similar to Shaggy-related protein kinase NtK-1 (EC 2.7.1.-). (Os 10t0521700-01) |
| Parent gene strand | - |
| Alternative splicing | Os10g0521700_circ_g.2 Os10g0521700_circ_g.3 Os10g0521700_circ_g.4 Os10g0521700_circ_g.5 Os10g0521700_circ_g.6 Os10g0521700_circ_g.7 Os10g0521700_circ_g.8 Os10g0521700_circ_g.9 Os10g0521700_circ_g.10 Os10g0521801_circ_g.1 Os10g0521801_circ_g.2 Os10g0521801_circ_g.3 Os10g0521801_circ_g.4 |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0521700-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_008612 zma_circ_003083 |
| PMCS | 0.309928729 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
20197789-20198346(-) 20197342-20198346(-) |
| Potential amino acid sequence |
MNPNYSEFKFPQIKAHPWHKLFGKRMPPEAVDLVSRLLQYSPNLRCTAVDACAHPFFDELRDPK TCLSNGRSLPPLFDFSAAGSW*(-) MLVLIHSLMNCGIPRPACQMDDHYHPCSTSQLLVPGEPNISYICSRYYRAPELIFGATEYTTAI DIWSVGCVLAELLIGQPLFPGESGVDQLVEIIKILGTPTREEIRCMNPNYSEFKFPQIKAHPWH KLFGKRMPPEAVDLVSRLLQYSPNLRCTAVDACAHPFFDELRDPKTCLSNGRSLPPLFDFSAAG SW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |