logo





circRNA ID
AT1G02090_circ_g.3
Alias
ath_circ_000210
Organism
Arabidpsis thaliana
Position
chr1: 389050-389301  JBrowse»
Reference genome
TAIR10.38
Type  
e-circRNA
Identification method
CIRCexplorer
Parent gene
Parent gene annotation
COP9 signalosome complex subunit 7
Parent gene strand
-
Splice junction sequence  
TAGCATATGACAAAGGGGTCATACATTTGTAGTCTCCCCAGGTGCCATGGGCAAACAAGCGTAG
TAGATCCAGGTACACAGAATCTGTGGTTCCTTCAAGcttgttagactcagcaagggtgaggaca
gtgagctgcttaagcttaagaatttggtcaggggacaagtgcggaagacgggtggcattgccta
gtgtttcg
Support reads
2
Tissues
seedlings
Exon boundary  
Yes-Yes
Splicing signals  
CT-AC
Sanger sequencing for BSS  
NA
PCR primers for BSS  
NA
Assembled circRNA sequence  
NA
Sanger sequencing for FL  
NA
PCR primers for FL  
NA
Genomic sequence
CTTGTTAGACTCAGCAAGGGTGAGGACAGTGAGCTGCTTAAGCTTAAGAATTTGGTCAGGGGAC
AAGTGCGGAAGACGGGTGGCATTGCCTAGTGTTTCGATGAAAGCAAGTCAAGAGGAGAGAATAT
GACAAAAGGGAAAACGAATTGAAATAGCATATGACAAAGGGGTCATACATTTGTAGTCTCCCCA
GGTGCCATGGGCAAACAAGCGTAGTAGATCCAGGTACACAGAATCTGTGGTTCCTTCAAG
Number of exons covered
AT1G02090.1:2
AT1G02090.2:2
AT1G02090.3:2
Conserved circRNAs
NA
Coding potential
Y
Potential coding position
389250-389052(-)
Potential amino acid sequence
MAPGETTNAMPPVFRTCPLTKFLSLSSSLSSPLLSLTSLKEPQILCTWIYYACLPMAPGETTNA
MPPVFRTCPLTKFLSLSSSLSSPLLSLTSLKEPQILCTWIYYACLPMAPGETTNAMPPVFRTCP
LTKFLSLSSSLSSPLLSLTSLKEPQILCTWIYYACLPMAPGETTNAMPPVFRTCPLTKFLSLSS
SLSSPLLSLT(-)
Sponge-miRNAs
NA
circRNA-miRNA-mRNA network
References
Pan et al., 2017

Copyright©2017-2021 Institute of Crop Sciences / Institute of Bioinformatics, Zhejiang University.
Any questions or suggestions, please contact the Fan's lab, bioinplant@zju.edu.cn
For submittion, please click here. Last modified at 2021-03-09.

Supported by   nsfc    zju