Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0488800_circ_g.4 |
| ID in PlantcircBase | osa_circ_007217 |
| Alias | Os_ciR1631 |
| Organism | Oryza sativa |
| Position | chr10: 18535295-18536210 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI, KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | Os10g0488800 |
| Parent gene annotation |
Myosin head, motor region domain containing protein. (Os10t04888 00-01);Similar to Myosin head family protein, expressed. (Os10t0 488800-02) |
| Parent gene strand | + |
| Alternative splicing | Os10g0488800_circ_igg.1 Os10g0488800_circ_igg.2 Os10g0488800_circ_g.1 Os10g0488800_circ_g.2 Os10g0488800_circ_g.3 Os10g0488800_circ_g.5 Os10g0488800_circ_g.6 Os10g0488800_circ_g.7 Os10g0488800_circ_g.8 |
| Support reads | 7/12 |
| Tissues | root/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0488800-01:4 Os10t0488800-02:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_002869* osi_circ_008547 |
| PMCS | 0.378752802 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18535367-18535345(+) 18535369-18535821(-) |
| Potential amino acid sequence |
MKVNNENIVQKLTLSQAIDTRDALAKSLYASLFEWLVEQINKSLSVGKRRTGRSISILDIYGFE SFDRNSFEQFCINYANERLQQHFNRHLFKLEQEEYVEDGIDWAKVEFEDNQNCLNLFEKRQKRS QDFLAAVLKISI*(+) MCLFDKAKLRSSILQPRSLATVSAVSQRDSNSSDCPQTQPLPSQCHLQRIPLVQA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |