Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0525600_circ_g.10 |
| ID in PlantcircBase | osa_circ_009465 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 19063496-19063921 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0525600 |
| Parent gene annotation |
Similar to Alpha-mannosidase. (Os11t0525600-01);Similar to Alpha -mannosidase. (Os11t0525600-02);Similar to predicted protein. (O s11t0525600-03);Similar to predicted protein. (Os11t0525600-04); Similar to predicted protein. (Os11t0525600-05) |
| Parent gene strand | + |
| Alternative splicing | Os11g0525600_circ_g.2 Os11g0525600_circ_g.3 Os11g0525600_circ_g.4 Os11g0525600_circ_g.5 Os11g0525600_circ_g.6 Os11g0525600_circ_g.7 Os11g0525600_circ_g.8 Os11g0525600_circ_g.9 Os11g0525600_circ_g.11 Os11g0525600_circ_g.12 Os11g0525600_circ_g.13 Os11g0525600_circ_g.14 Os11g0525600_circ_g.15 Os11g0525600_circ_g.16 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os11t0525600-01:3 Os11t0525600-03:3 Os11t0525600-02:3 Os11t0525600-05:3 Os11t0525600-04:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.217037676 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19063896-19063498(-) 19063659-19063904(-) |
| Potential amino acid sequence |
MHFVQYGPTENCQRNLSISLDRNCAIRAKYVCSRSLRITSISILSYVILVLLLKICFNLIYPWI NLLMHFVQYGPTENCQRNLSISLDRNCAIRAKYVCSRSLRITSISILSYVILVLLLKICFNLIY PWINLLMHFVQYGPTENCQRNLSISLDRNCAIRAKYVCSRSLRITSISILSYVILVLLLKICFN LIYPWINLLMHFVQYGPTENCQRNLSISLDRNCAIRAKYVCSRSLRITSISILSYVILVLLLKI CFN(-) MLQKPEDHFHFHPVLCNTCTSAQNLLQPDISMD*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |