logo





circRNA ID
AT1G02080_circ_g.25
Alias
ath_circ_000196, Ath_circ_FC0136
Organism
Arabidpsis thaliana
Position
chr1: 382373-383688  JBrowse»
Reference genome
TAIR10.38
Type  
e-circRNA
Identification method
PcircRNA_finder
Parent gene
Parent gene annotation
Transcription regulator
Parent gene strand
+
Splice junction sequence  
CATGTTAGCTTTTTCTTAGGTTGCGTGCAACACCACTAACACAGAAGAGAGTACCAGCTTGGAT
TATGTGGAATCAGATCCTGCGGGTTTCCAGAATCGGgccgtaatttctgaagttcctgaaatca
tcctcagatgtataagcagagatgaagccgcttttgctgtcgctcaaaaagctttcaaggctct
ttacgaga
Support reads
19
Tissues
whole_plant
Exon boundary  
Yes-Yes
Splicing signals  
GT-AG
Sanger sequencing for BSS  
NA
PCR primers for BSS  
NA
Assembled circRNA sequence  
NA
Sanger sequencing for FL  
NA
PCR primers for FL  
NA
Genomic sequence
GCCGTAATTTCTGAAGTTCCTGAAATCATCCTCAGATGTATAAGCAGAGATGAAGCCGCTTTTG
CTGTCGCTCAAAAAGCTTTCAAGGCTCTTTACGAGAATGCATCAAGTAACCTTCACGTCAGTGC
TAACCTAGCAATACTTGTTGCTATCCGTGATGTTTGCAAGCGTGTTGTTAAAGAGCTCACTAGT
TGGGTATGTTTACAACCTTTTCAAGATTTCACTTCGCTGATGTGCTTTGTTCAGTTACTTCTCC
ATTAATTTGTCACTATTTCTGTCAGAACACATAGGATAACACATATCATATAAGTGCTAGGTCG
AGTCTGTTTCCTGTAGTTGGAGCCTATCCTCAACTGGTTATAGATACTAGATTTGTTTCTTTGG
TATTTTTAGTTATAATTAATTATCTTTCTTCAAACTTTTGACACAGGTGATTTATTCAGAGGAG
GATCGGAAGCTCAACAAAGATATTACTATTGGTCTTATCCAGCGTGAGTTGCTTAGCCTAGCGG
AGTACAATGTCCACATGGCGAAGCATCTTGATGGAGGGAGAAACAGTATGCTGAATTGCTTAAC
CTTTGTTGATGTCCTTGTGTGGTAACATTCTTTTTTTGTTTTGGCTAGTGAACTTGTTTTAACA
AGTTGTTTGTTACGCAGAGACCGCAACTGACTTTGCTATTTCTCTACTCCAATCCTTGGTCACT
GAGGAGTCGAGTGTCATTTCAGAGCTCCACAGTCTTGTTGATGCGCTGGCAAAGGTTGCAATTT
TAACATTCTTCTGCGTTTGTTGTTGCAGTCGCATATTCTTGTTCTATTATATAAAAAAACAGTT
AATAGGTGTGAAAACATACAACTAGGGAAGGGATAGGTTCAATTTTTTTTTTTTGTGGTTAAAT
CTACTGCATAACACTGTTTATCATATAATGCCAACTGACAAGTATTGTGGTTAGGTTCAAATAT
TATGAAATTTGGCATTGTTATATTTGGTGACGCTGCAATTTGTATTCTTGTTTTGGTTGTAGCT
TGCCTCAAAATCCGGATCTTCTGAGTCATTGCAACAGCTAATTGACATCATACGAAATCCAGTT
ACTAACACAGCTGGCCTCTCTGATAGTTCAACCGGAAATGATAACAACGATAGGCAAAAGGATG
AGAAGGTGTCAGATGTCTTCATTACCGAATGTTGCCTGTAATCAGACTGTAAATGTATATTTGA
CATGTTAGCTTTTTCTTAGGTTGCGTGCAACACCACTAACACAGAAGAGAGTACCAGCTTGGAT
TATGTGGAATCAGATCCTGCGGGTTTCCAGAATCGG
Number of exons covered
AT1G02080.3:5
AT1G02080.2:5
AT1G02080.1:5
Conserved circRNAs
NA
Coding potential
Y
Potential coding position
382899-383685(+)
Potential amino acid sequence
MAKHLDGGRNKTATDFAISLLQSLVTEESSVISELHSLVDALAKLASKSGSSESLQQLIDIIRN
PVTNTAGLSDSSTGNDNNDRQKDEKVACNTTNTEESTSLDYVESDPAGFQNRAVISEVPEIILR
CISRDEAAFAVAQKAFKALYENASSNLHVSANLAILVAIRDVCKRVVKELTSWVIYSEEDRKLN
KDITIGLIQRELLSLAEYNVHMAKHLDGGRNKTATDFAISLLQSLVTEESSVISELHSLVDALA
KLASKSGSSESLQQLIDIIRNPVTNTAGLSDSSTGNDNNDRQKDEKVACNTTNTEESTSLDYVE
SDPAGFQNRAVISEVPEIILRCISRDEAAFAVAQKAFKALYENASSNLHVSANLAILVAIRDVC
KRVVKELTSWVIYSEEDRKLNKDITIGLIQRELLSLAEYNVHMAKHLDGGRNKTATDFAISLLQ
SLVTEESSVISELHSLVDALAKLASKSGSSESLQQLIDIIRNPVTNTAGLSDSSTGNDNNDRQK
DEKVACNTTNTEESTSLDYVESDPAGFQNRAVISEVPEIILRCISRDEAAFAVAQKAFKALYEN
ASSNLHVSANLAILVAIRDVCKRVVKELTSWVIYSEEDRKLNKDITIGLIQRELLSLAEYNVHM
AKHLDGGRNKTATDFAISLLQSLVTEESSVISELHSLVDALAKLASKSGSSESLQQLIDIIRNP
VTNTAGLSDSSTGNDNNDRQKDEKVACNTTNTEESTSLDYVESDPAGFQNR(+)
Sponge-miRNAs
NA
circRNA-miRNA-mRNA network
References
Chu et al., 2017;Chen et al., 2017

Copyright©2017-2021 Institute of Crop Sciences / Institute of Bioinformatics, Zhejiang University.
Any questions or suggestions, please contact the Fan's lab, bioinplant@zju.edu.cn
For submittion, please click here. Last modified at 2021-03-09.

Supported by   nsfc    zju