logo





circRNA ID
AT1G02080_circ_g.32
Alias
ath_circ_000203, At_ciR791
Organism
Arabidpsis thaliana
Position
chr1: 384694-384840  JBrowse»
Reference genome
TAIR10.38
Type  
e-circRNA
Identification method
CIRCexplorer, find_circ, CIRI-full
Parent gene
Parent gene annotation
Transcription regulator
Parent gene strand
+
Splice junction sequence  
TTTCCGATTGTTCATCAACTGGCTACTGGACTTGTGTTCCCTGGATCCTGGGACGGATGGTGCA
AACTTTCAGatcatggctgacacagtgagatttattcaaaaggacgcagaagataaaaagacat
cactcaattctaaaccata
Support reads
9/1
Tissues
leaf/root
Exon boundary  
Yes-Yes
Splicing signals  
GT-AG
Sanger sequencing for BSS  
NA
PCR primers for BSS  
NA
Assembled circRNA sequence  
ATCATGGCTGACACAGTGAGATTTATTCAAAAGGACGCAGAAGATAAAAAGACATCACTCAATT
CTAAACCATATTTCCGATTGTTCATCAACTGGCTACTGGACTTGTGTTCCCTGGATCCTGGGAC
GGATGGTGCAAACTTTCAGATCATGGCTGACACAGTGAGATTTATTCAAAAGGACGCAGAAGAT
AAAAAGACATCACTCAATTCTAAACCATATTTCCGATTGTTCATCAACTGGCTACTGGACTTGT
GTTCCCTGGATCCTGGGACGGATGGTGCAAACTTTCAGATCATGGCTGACACAGTGAGATTTAT
TCAAAAGGACGCAGAAGATAAAAAGACATCACTCAATTCTAAACCATATTTCCGATTGTTCATC
AACTGGCTACTGGACTTGTGTTCCCTGGATCCTGGGACGGATGGTGCAAACTTTCAG
Sanger sequencing for FL  
NA
PCR primers for FL  
NA
Genomic sequence
ATCATGGCTGACACAGTGAGATTTATTCAAAAGGACGCAGAAGATAAAAAGACATCACTCAATT
CTAAACCATATTTCCGATTGTTCATCAACTGGCTACTGGACTTGTGTTCCCTGGATCCTGGGAC
GGATGGTGCAAACTTTCAG
Number of exons covered
AT1G02080.2:1
AT1G02080.1:1
AT1G02080.3:1
Conserved circRNAs
NA
Coding potential
Y
Potential coding position
384697-384837(+)
Potential amino acid sequence
MADTVRFIQKDAEDKKTSLNSKPYFRLFINWLLDLCSLDPGTDGANFQIMADTVRFIQKDAEDK
KTSLNSKPYFRLFINWLLDLCSLDPGTDGANFQIMADTVRFIQKDAEDKKTSLNSKPYFRLFIN
WLLDLCSLDPGTDGANFQIMADTVRFIQKDAEDKKTSLNSKPYFRLFINWLLDLCSLDPGTDGA
NFQ(+)
Sponge-miRNAs
NA
circRNA-miRNA-mRNA network
References
Ye et al., 2015;Chu et al., 2017

Copyright©2017-2021 Institute of Crop Sciences / Institute of Bioinformatics, Zhejiang University.
Any questions or suggestions, please contact the Fan's lab, bioinplant@zju.edu.cn
For submittion, please click here. Last modified at 2021-03-09.

Supported by   nsfc    zju