Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G02080_circ_g.27 |
ID in PlantcircBase | ath_circ_000198 |
Alias | At_ciR207, Ath_circ_FC0001, Ath_circ_FC4916, AT1G02080_C1 |
Organism | Arabidpsis thaliana |
Position | chr1: 382803-383130 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, CIRI, KNIFE, MapSplice, PcircRNA_finder, circRNA_finder, find_circ, CIRI-full, CIRI2 |
Parent gene | AT1G02080 |
Parent gene annotation |
Transcription regulator |
Parent gene strand | + |
Alternative splicing | AT1G02080_circ_g.22 AT1G02080_circ_g.23 AT1G02080_circ_g.24 AT1G02080_circ_g.25 AT1G02080_circ_g.26 AT1G02080_circ_g.28 AT1G02080_circ_g.29 AT1G02080_circ_g.30 AT1G02080_circ_g.31 AT1G02080_circ_g.32 AT1G02080_circ_g.33 AT1G02080_circ_g.34 AT1G02080_circ_g.35 |
Support reads | 24/6/3 |
Tissues | leaf/root, leaf, aerial, seed, whole_plant/seedlings |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G02080.3:2 AT1G02080.2:2 AT1G02080.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.555059522 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
382899-383127(+) |
Potential amino acid sequence |
MAKHLDGGRNKTATDFAISLLQSLVTEESSVISELHSLVDALAKVIYSEEDRKLNKDITIGLIQ RELLSLAEYNVHMAKHLDGGRNKTATDFAISLLQSLVTEESSVISELHSLVDALAKVIYSEEDR KLNKDITIGLIQRELLSLAEYNVHMAKHLDGGRNKTATDFAISLLQSLVTEESSVISELHSLVD ALAKVIYSEEDRKLNKDITIGLIQRELLSLAEYNVHMAKHLDGGRNKTATDFAISLLQSLVTEE SSVISELHSLVDALAK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017;Pan et al., 2017;Chen et al., 2017a;Liu et al., 2017;Zhang et al., 2019 |