Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0300200_circ_g.4 |
| ID in PlantcircBase | osa_circ_001450 |
| Alias | Os_ciR5702 |
| Organism | Oryza sativa |
| Position | chr1: 11000986-11001113 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os01g0300200 |
| Parent gene annotation |
Similar to ATP-citrate lyase subunit B. (Os01t0300200-01);Simila r to ATP-citrate lyase subunit B. (Os01t0300200-02);Similar to A CLB-1 (ATP-citrate lyase B-1). (Os01t0300200-03) |
| Parent gene strand | - |
| Alternative splicing | Os01g0300200_circ_g.5 Os01g0300200_circ_g.6 Os01g0300200_circ_g.7 Os01g0300200_circ_g.8 Os01g0300200_circ_g.9 Os01g0300200_circ_g.10 Os01g0300200_circ_g.11 Os01g0300200_circ_g.12 Os01g0300200_circ_g.13 Os01g0300200_circ_g.14 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0300200-02:1 Os01t0300200-03:1 Os01t0300200-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.324867057 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11001100-11001070(-) 11001086-11001070(-) |
| Potential amino acid sequence |
MLVSPCLQLLNRVMELVTLFRFCGSSAVFLVTALSLLRRGTLLCWCPHVYNY*(-) MSTIIEQGYGVGDVISLLWFKRSLPRYCTQFIEARNPAMLVSPCLQLLNRVMELVTLFRFCGSS AVFLVTALSLLRRGTLLCWCPHVYNY*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |