Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0558725_circ_g.1 |
| ID in PlantcircBase | osa_circ_007986 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 21989763-21990010 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0558725 |
| Parent gene annotation |
Hypothetical protein. (Os10t0558725-00) |
| Parent gene strand | + |
| Alternative splicing | Os10g0558700_circ_igg.1 Os10g0558725_circ_igg.1 Os10g0558725_circ_ag.1 Os10g0558725_circ_ag.2 Os10g0558725_circ_ag.3 Os10g0558750_circ_igg.1 Os10g0558750_circ_igg.2 Os10g0558750_circ_ag.1 Os10g0558750_circ_ag.2 Os10g0558900_circ_igg.1 Os10g0559300_circ_igg.1 EPlOSAG00000044329_circ_ig.1 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0558700-01:1 Os10t0558700-02:1 Os10t0558700-03:1 Os10t0558700-01:1 Os10t0558725-00:1 Os10t0558700-02:1 Os10t0558700-03:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.21733871 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21990000-21989822(+) 21989838-21989982(-) |
| Potential amino acid sequence |
MVNELKDAGEVGQNLRSLESLGWT*(+) MLYLHVHPSDSRDLRFWPTSPASFSSLTMECQMK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |