Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0558725_circ_g.1 |
ID in PlantcircBase | osa_circ_007986 |
Alias | NA |
Organism | Oryza sativa |
Position | chr10: 21989763-21990010 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os10g0558725 |
Parent gene annotation |
Hypothetical protein. (Os10t0558725-00) |
Parent gene strand | + |
Alternative splicing | Os10g0558700_circ_igg.1 Os10g0558725_circ_igg.1 Os10g0558725_circ_ag.1 Os10g0558725_circ_ag.2 Os10g0558725_circ_ag.3 Os10g0558750_circ_igg.1 Os10g0558750_circ_igg.2 Os10g0558750_circ_ag.1 Os10g0558750_circ_ag.2 Os10g0558900_circ_igg.1 Os10g0559300_circ_igg.1 EPlOSAG00000044329_circ_ig.1 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os10t0558700-01:1 Os10t0558700-02:1 Os10t0558700-03:1 Os10t0558700-01:1 Os10t0558725-00:1 Os10t0558700-02:1 Os10t0558700-03:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.21733871 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21990000-21989822(+) 21989838-21989982(-) |
Potential amino acid sequence |
MVNELKDAGEVGQNLRSLESLGWT*(+) MLYLHVHPSDSRDLRFWPTSPASFSSLTMECQMK*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |