Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA003571_circ_g.2 |
ID in PlantcircBase | osi_circ_002059 |
Alias | 1:17823350|17825504 |
Organism | Oryza sativa ssp. indica |
Position | chr1: 17823350-17825504 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA003571 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA003571_circ_igg.1 BGIOSGA003571_circ_igg.2 BGIOSGA003571_circ_igg.3 BGIOSGA003571_circ_igg.4 BGIOSGA003571_circ_igg.5 BGIOSGA003571_circ_g.1 BGIOSGA003571_circ_g.3 BGIOSGA003571_circ_g.4 BGIOSGA003571_circ_g.5 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA003571-TA:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_001769* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17825084-17823497(+) |
Potential amino acid sequence |
MSSTVKDCTPKAYEWDYRWMTYPSEARYFKHPYDQSLSTFRGHSVLRTLIRCYFSPIHSKFTKA WSSLMMMMGSPLPYFLLSFQKMAENLLLETTMNQYVFTILDQTK*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |