Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA015140_circ_g.10 |
ID in PlantcircBase | osi_circ_005450 |
Alias | 4:18028575|18029898 |
Organism | Oryza sativa ssp. indica |
Position | chr4: 18028575-18029898 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA015140 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA015140_circ_g.1 BGIOSGA015140_circ_g.2 BGIOSGA015140_circ_g.3 BGIOSGA015140_circ_g.4 BGIOSGA015140_circ_g.5 BGIOSGA015140_circ_g.6 BGIOSGA015140_circ_g.7 BGIOSGA015140_circ_g.8 BGIOSGA015140_circ_g.9 BGIOSGA015140_circ_g.11 BGIOSGA015140_circ_g.12 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA015140-TA:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_023751* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18029308-18029889(-) 18029493-18028622(+) |
Potential amino acid sequence |
MLEGFRNHLDYRYSEYKRMRAAIDQHEGGLDAFSRGYEKLGFTRSAEGITYREWAPGAQSAALV GDFNNWNPNADTMTRVAL*(-) MESLPPPQKVLLYYHQVSEILQVALEFPRLVPQRTASRRSHRQAPAPSQEHPRSSQRHSGHSIC IWVPIVEVTY*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |