Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA014529_circ_g.10 |
| ID in PlantcircBase | osi_circ_005673 |
| Alias | 4:27429893|27431422 |
| Organism | Oryza sativa ssp. indica |
| Position | chr4: 27429893-27431422 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA014529 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | BGIOSGA014529_circ_g.1 BGIOSGA014529_circ_g.2 BGIOSGA014529_circ_g.3 BGIOSGA014529_circ_g.4 BGIOSGA014529_circ_g.5 BGIOSGA014529_circ_g.6 BGIOSGA014529_circ_g.7 BGIOSGA014529_circ_g.8 BGIOSGA014529_circ_g.9 BGIOSGA014529_circ_g.11 BGIOSGA014529_circ_g.12 BGIOSGA014529_circ_g.13 BGIOSGA014529_circ_g.14 BGIOSGA014529_circ_g.15 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | BGIOSGA014529-TA:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osa_circ_024935* |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27431400-27429895(-) 27429976-27429908(+) |
| Potential amino acid sequence |
MLNLVVISETSRTDDDDDDDEKAMLIGTPLDATQESKLIHILVVRSIQAAYKHVDNSIFEGMLN LVVISETSRTDDDDDDDEKAMLIGTPLDATQESKLIHILVVRSIQAAYKHVDNSIFEGMLNLVV ISETSRTDDDDDDDEKAMLIGTPLDATQESKLIHILVVRSIQAAYKHVDNSIFEGMLNLVVISE TSRTDDDDDDDEKAMLIGTPLDATQESKLIHILVVRSIQAAYKH(-) MSMAFSSSSSSSSVRLVSEITTKFSMPSKIELSTCLYAA*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |