Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0566500_circ_g.10 |
ID in PlantcircBase | osa_circ_024921 |
Alias | Os_ciR1069 |
Organism | Oryza sativa |
Position | chr4: 28432301-28432521 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, circseq_cup, find_circ |
Parent gene | Os04g0566500 |
Parent gene annotation |
Similar to Isoform 2 of Protein argonaute 1B. (Os04t0566500-01); Similar to Isoform 2 of Protein argonaute 1B. (Os04t0566500-02); Similar to Argonaute protein. (Os04t0566500-03);Similar to Argon aute protein. (Os04t0566500-04) |
Parent gene strand | - |
Alternative splicing | Os04g0566500_circ_g.3 Os04g0566500_circ_g.4 Os04g0566500_circ_g.5 Os04g0566500_circ_g.6 Os04g0566500_circ_g.7 Os04g0566500_circ_g.8 Os04g0566500_circ_g.9 Os04g0566500_circ_g.11 Os04g0566500_circ_g.12 Os04g0566500_circ_g.13 |
Support reads | 21/7/7 |
Tissues | root/root/shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0566500-01:1 Os04t0566500-03:1 Os04t0566500-02:1 Os04t0566500-04:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_014673 |
PMCS | 0.530360294 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28432475-28432487(-) 28432417-28432507(-) |
Potential amino acid sequence |
MFELVTLYRYSHLGGRLPAYDGRKSLYTAGPLPFASRTFEITLQDEEDSLGGGQGTQRYLLLLR LLHVA*(-) MMEGRVFTQLDHCHLLLGHLKLLFKMRKIVLVVAKAPKGIYYS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to Pi-starvation |
Other Information | |
---|---|
References | Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |