Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0566500_circ_g.3 |
ID in PlantcircBase | osa_circ_024914 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 28429974-28431326 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0566500 |
Parent gene annotation |
Similar to Isoform 2 of Protein argonaute 1B. (Os04t0566500-01); Similar to Isoform 2 of Protein argonaute 1B. (Os04t0566500-02); Similar to Argonaute protein. (Os04t0566500-03);Similar to Argon aute protein. (Os04t0566500-04) |
Parent gene strand | - |
Alternative splicing | Os04g0566500_circ_g.4 Os04g0566500_circ_g.5 Os04g0566500_circ_g.6 Os04g0566500_circ_g.7 Os04g0566500_circ_g.8 Os04g0566500_circ_g.9 Os04g0566500_circ_g.10 Os04g0566500_circ_g.11 Os04g0566500_circ_g.12 Os04g0566500_circ_g.13 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0566500-01:3 Os04t0566500-03:3 Os04t0566500-02:3 Os04t0566500-04:3 |
Conservation Information | |
---|---|
Conserved circRNAs | zma_circ_000996 |
PMCS | 0.136702993 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28431269-28430049(+) 28431195-28431314(-) 28430022-28431314(-) |
Potential amino acid sequence |
MSPENIAPQSSQYHDHRQGILGGGRTRASTDARRSSIFMPNSCAY*(+) MEVCKIVEGQRYSKRLNEKQITALLKVTCQRPQERELDILRTVSHNAYHEDQYAQEFGIKIDER LASVEARVLPPPRIPCR*(-) MSVLHLLKLVFCLPQGFPVDDRGTVKTVVQYFLETYGFSIQHTTLPCLQVGNQQRPNYLPMEVC KIVEGQRYSKRLNEKQITALLKVTCQRPQERELDILRTVSHNAYHEDQYAQEFGIKIDERLASV EARVLPPPRIPCR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |