Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA016994_circ_g.2 |
| ID in PlantcircBase | osi_circ_005688 |
| Alias | 4:28344529|28345817 |
| Organism | Oryza sativa ssp. indica |
| Position | chr4: 28344529-28345817 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA016994 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | BGIOSGA014482_circ_igg.1 BGIOSGA016994_circ_g.1 BGIOSGA016994_circ_g.3 BGIOSGA016994_circ_g.4 BGIOSGA014479_circ_g.1 BGIOSGA016995_circ_g.1 BGIOSGA014476_circ_g.1 BGIOSGA014475_circ_igg.1 BGIOSGA014475_circ_g.1 BGIOSGA014475_circ_g.2 BGIOSGA014474_circ_g.1 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | BGIOSGA016994-TA:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osa_circ_025000* |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28345772-28344607(+) 28344866-28344567(+) |
| Potential amino acid sequence |
MAQHLRTPRFVILWMQSNFYRCCRKPILRSSRSVVETLWTRS*(+) MLNPRPKERLTAHEVLCHPWIRDHGVAPDRPLDPAVLSRIKQFSAMNKLKKMALRVIAESLSEE EIAGLKEMFQTMDADNSGAITYDELKEGLRKYGSTLKDTEIRDLMDAVKLLPMLSEAHIT*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |