Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA016994_circ_g.2 |
ID in PlantcircBase | osi_circ_005688 |
Alias | 4:28344529|28345817 |
Organism | Oryza sativa ssp. indica |
Position | chr4: 28344529-28345817 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA016994 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA014482_circ_igg.1 BGIOSGA016994_circ_g.1 BGIOSGA016994_circ_g.3 BGIOSGA016994_circ_g.4 BGIOSGA014479_circ_g.1 BGIOSGA016995_circ_g.1 BGIOSGA014476_circ_g.1 BGIOSGA014475_circ_igg.1 BGIOSGA014475_circ_g.1 BGIOSGA014475_circ_g.2 BGIOSGA014474_circ_g.1 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA016994-TA:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_025000* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28345772-28344607(+) 28344866-28344567(+) |
Potential amino acid sequence |
MAQHLRTPRFVILWMQSNFYRCCRKPILRSSRSVVETLWTRS*(+) MLNPRPKERLTAHEVLCHPWIRDHGVAPDRPLDPAVLSRIKQFSAMNKLKKMALRVIAESLSEE EIAGLKEMFQTMDADNSGAITYDELKEGLRKYGSTLKDTEIRDLMDAVKLLPMLSEAHIT*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |