Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0584600_circ_g.4 |
ID in PlantcircBase | osa_circ_025000 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 29532865-29534153 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0584600 |
Parent gene annotation |
Similar to Calcium dependent protein kinase. (Os04t0584600-01);S imilar to Calcium-dependent protein kinase. (Os04t0584600-02);Si milar to cDNA clone:001-041-E12, full insert sequence. (Os04t058 4600-03) |
Parent gene strand | + |
Alternative splicing | Os04g0584600_circ_g.3 Os04g0584600_circ_g.5 Os04g0584600_circ_g.6 Os04g0584600_circ_g.7 Os04g0584600_circ_g.8 Os04g0584600_circ_g.9 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0584600-02:4 Os04t0584600-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_005688* |
PMCS | 0.315053957 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29534108-29532943(+) 29533202-29532903(+) |
Potential amino acid sequence |
MAQHLRTPRFVILWMQSNFYRCCRKPILRSSRSVVETLWTRS*(+) MLNPRPKERLTAHEVLCHPWIRDHGVAPDRPLDPAVLSRIKQFSAMNKLKKMALRVIAESLSEE EIAGLKEMFQTMDADNSGAITYDELKEGLRKYGSTLKDTEIRDLMDAVKLLPMLSEAHIT*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |