Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA011991_circ_g.8 |
ID in PlantcircBase | osi_circ_004591 |
Alias | 3:4731131|4731792 |
Organism | Oryza sativa ssp. indica |
Position | chr3: 4731131-4731792 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA011991 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA011991_circ_g.2 BGIOSGA011991_circ_g.3 BGIOSGA011991_circ_g.4 BGIOSGA011991_circ_g.5 BGIOSGA011991_circ_igg.1 BGIOSGA011991_circ_g.2 BGIOSGA011991_circ_g.3 BGIOSGA011991_circ_g.4 BGIOSGA011991_circ_g.5 BGIOSGA011991_circ_igg.6 BGIOSGA011991_circ_g.7 BGIOSGA011991_circ_g.9 BGIOSGA011991_circ_g.10 BGIOSGA011991_circ_g.11 BGIOSGA011991_circ_g.12 BGIOSGA011991_circ_g.13 BGIOSGA011991_circ_g.14 BGIOSGA011991_circ_g.15 BGIOSGA011991_circ_ig.1 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA011991-TA:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_018238* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4731170-4731767(-) 4731778-4731170(+) 4731551-4731170(+) |
Potential amino acid sequence |
MKASCLVVYIRFHLMHPHTLM*(-) MRMHQVKPDVDYKTTRLHFENLALRYGNPIIILNLIKTREKKPRESLLRAEFAKAIHYINKGLP DDKRLKFLHMDLSKLSRRKGTNVLSLLNKVASDVLDLTDFLHCEITTSKYEDASSETGCRLQDN SPSF*(+) MDLSKLSRRKGTNVLSLLNKVASDVLDLTDFLHCEITTSKYEDASSETGCRLQDNSPSF*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |