Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0182400_circ_g.18 |
ID in PlantcircBase | osa_circ_018238 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 4331576-4332237 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0182400 |
Parent gene annotation |
Similar to SAC domain protein 1 (FIG4-like protein AtFIG4). (Os0 3t0182400-01) |
Parent gene strand | + |
Alternative splicing | Os03g0182400_circ_g.1 Os03g0182400_circ_g.2 Os03g0182400_circ_g.3 Os03g0182400_circ_g.4 Os03g0182400_circ_g.5 Os03g0182400_circ_g.6 Os03g0182400_circ_g.7 Os03g0182400_circ_g.8 Os03g0182400_circ_g.9 Os03g0182400_circ_g.10 Os03g0182400_circ_g.11 Os03g0182400_circ_g.12 Os03g0182400_circ_g.13 Os03g0182400_circ_g.14 Os03g0182400_circ_g.15 Os03g0182400_circ_g.16 Os03g0182400_circ_g.17 Os03g0182400_circ_g.19 Os03g0182400_circ_g.20 Os03g0182400_circ_g.21 |
Support reads | 1 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0182400-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_004591* |
PMCS | 0.323357326 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
4332223-4331615(+) 4331996-4331615(+) 4331615-4332212(-) |
Potential amino acid sequence |
MRMHQVKPDVDYKTTRLHFENLALRYGNPIIILNLIKTREKKPRESLLRAEFAKAIHYINKGLP DDKRLKFLHMDLSKLSRRKGTNVLSLLNKVASDVLDLTDFLHCEITTSKYEDASSETGCRLQDN SPSF*(+) MDLSKLSRRKGTNVLSLLNKVASDVLDLTDFLHCEITTSKYEDASSETGCRLQDNSPSF*(+) MKASCLVVYIRFHLMHPHTLM*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |