Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0182400_circ_g.18 |
| ID in PlantcircBase | osa_circ_018238 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 4331576-4332237 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0182400 |
| Parent gene annotation |
Similar to SAC domain protein 1 (FIG4-like protein AtFIG4). (Os0 3t0182400-01) |
| Parent gene strand | + |
| Alternative splicing | Os03g0182400_circ_g.1 Os03g0182400_circ_g.2 Os03g0182400_circ_g.3 Os03g0182400_circ_g.4 Os03g0182400_circ_g.5 Os03g0182400_circ_g.6 Os03g0182400_circ_g.7 Os03g0182400_circ_g.8 Os03g0182400_circ_g.9 Os03g0182400_circ_g.10 Os03g0182400_circ_g.11 Os03g0182400_circ_g.12 Os03g0182400_circ_g.13 Os03g0182400_circ_g.14 Os03g0182400_circ_g.15 Os03g0182400_circ_g.16 Os03g0182400_circ_g.17 Os03g0182400_circ_g.19 Os03g0182400_circ_g.20 Os03g0182400_circ_g.21 |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0182400-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_004591* |
| PMCS | 0.323357326 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4332223-4331615(+) 4331996-4331615(+) 4331615-4332212(-) |
| Potential amino acid sequence |
MRMHQVKPDVDYKTTRLHFENLALRYGNPIIILNLIKTREKKPRESLLRAEFAKAIHYINKGLP DDKRLKFLHMDLSKLSRRKGTNVLSLLNKVASDVLDLTDFLHCEITTSKYEDASSETGCRLQDN SPSF*(+) MDLSKLSRRKGTNVLSLLNKVASDVLDLTDFLHCEITTSKYEDASSETGCRLQDNSPSF*(+) MKASCLVVYIRFHLMHPHTLM*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |