Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA011991_circ_g.12 |
| ID in PlantcircBase | osi_circ_004592 |
| Alias | 3:4731442|4732808 |
| Organism | Oryza sativa ssp. indica |
| Position | chr3: 4731442-4732808 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA011991 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | BGIOSGA011991_circ_g.2 BGIOSGA011991_circ_g.3 BGIOSGA011991_circ_g.4 BGIOSGA011991_circ_g.5 BGIOSGA011991_circ_igg.1 BGIOSGA011991_circ_g.2 BGIOSGA011991_circ_g.3 BGIOSGA011991_circ_g.4 BGIOSGA011991_circ_g.5 BGIOSGA011991_circ_igg.6 BGIOSGA011991_circ_g.7 BGIOSGA011991_circ_g.8 BGIOSGA011991_circ_g.9 BGIOSGA011991_circ_g.10 BGIOSGA011991_circ_g.11 BGIOSGA011991_circ_g.13 BGIOSGA011991_circ_g.14 BGIOSGA011991_circ_g.15 BGIOSGA011991_circ_ig.1 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | BGIOSGA011991-TA:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osa_circ_018239* |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4731503-4732775(-) 4731551-4731535(+) |
| Potential amino acid sequence |
MYSLCEFCTEQRFTRFLLTSTFIESCFSGSV*(-) MDLSKLSRRKGTNVLSLLNKVASDVLDLTDFLHCEITTSKYEDASSGQGAVANSGDIENIQDQN LCATKLVPLLLQKGVLRTNCIDCLDRTNVAQFAYGLAALGRQLHVLQLNETPTIELHAPLADDL MDFYERMGDTLAIQYGGSAAHNKIFCEQRGQWKAATQSQEFLRTLQRYYSNAYTDPEKQDSINV LVRRNLVNLCSVQNSQRLYIILTRGCQMTNV*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |