Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0609700_circ_g.2 |
| ID in PlantcircBase | osa_circ_025157 |
| Alias | Os_ciR9553 |
| Organism | Oryza sativa |
| Position | chr4: 30889012-30889961 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os04g0609700 |
| Parent gene annotation |
Zinc finger, RING/FYVE/PHD-type domain containing protein. (Os04 t0609700-01);Similar to H0702G05.10 protein. (Os04t0609700-02) |
| Parent gene strand | - |
| Alternative splicing | Os04g0609700_circ_g.1 Os04g0609700_circ_g.3 Os04g0609700_circ_g.4 Os04g0609700_circ_g.5 Os04g0609700_circ_g.6 Os04g0609700_circ_g.7 Os04g0609700_circ_g.8 Os04g0609700_circ_g.9 Os04g0609700_circ_igg.1 Os04g0609700_circ_g.2 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0609700-02:1 Os04t0609700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.226578614 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30889960-30889896(-) |
| Potential amino acid sequence |
MHGSKCKVGSYCTVGRRLQEVNILGGLILPVWGTIEKALAKQVRQSHKRVRVVRLETTTDNQRI VGLLIPNSAVESVLTVYAWIEMQSGKLLYSGKKVARG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |