Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0212600_circ_g.3 |
ID in PlantcircBase | osa_circ_018489 |
Alias | Os_ciR2289 |
Organism | Oryza sativa |
Position | chr3: 5867734-5868481 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os03g0212600 |
Parent gene annotation |
Targeting for Xklp2 family protein. (Os03t0212600-01) |
Parent gene strand | + |
Alternative splicing | Os03g0212600_circ_igg.1 Os03g0212600_circ_g.1 Os03g0212600_circ_g.2 Os03g0212600_circ_g.4 Os03g0212600_circ_g.5 Os03g0212600_circ_g.6 |
Support reads | 5/2 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0212600-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_014043 |
PMCS | 0.33687803 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5867783-5867746(+) 5867816-5868442(-) |
Potential amino acid sequence |
MLMEEEQQRIHIAQGLPWTTDEPECLIKPPVKETTEPVDLVLHSDVRAIERAEFDQYVSERNKF AEQLRLERERQQKLEEEEMIKQLRKELVPKAQPMPYFDRPFIPKSNGEG*(+) MYTLLLFLHKHFLYFLNKLLFLHPSPLLFGMNGRSKYGIG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |