Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0212600_circ_g.6 |
ID in PlantcircBase | osa_circ_018492 |
Alias | Os_ciR9108 |
Organism | Oryza sativa |
Position | chr3: 5868124-5868763 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os03g0212600 |
Parent gene annotation |
Targeting for Xklp2 family protein. (Os03t0212600-01) |
Parent gene strand | + |
Alternative splicing | Os03g0212600_circ_igg.1 Os03g0212600_circ_g.1 Os03g0212600_circ_g.2 Os03g0212600_circ_g.3 Os03g0212600_circ_g.4 Os03g0212600_circ_g.5 |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0212600-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.114192995 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5868403-5868127(+) 5868762-5868127(+) |
Potential amino acid sequence |
MIKQLRKELVPKAQPMPYFDRPFIPKRSAKPATVPKEPKFHPRPEKQSCA*(+) MCLIKPPVKETTEPVDLVLHSDVRAIERAEFDQYVSERNKFAEQLRLERERQQKLEEEEMIKQL RKELVPKAQPMPYFDRPFIPKRSAKPATVPKEPKFHPRPEKQSCA*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |