Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0513900_circ_g.4 |
| ID in PlantcircBase | osa_circ_001927 |
| Alias | Os_ciR1299 |
| Organism | Oryza sativa |
| Position | chr1: 18152219-18152777 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0513900 |
| Parent gene annotation |
Similar to Kinesin heavy chain (Fragment). (Os01t0513900-01) |
| Parent gene strand | + |
| Alternative splicing | Os01g0513900_circ_g.1 Os01g0513900_circ_g.2 Os01g0513900_circ_g.3 Os01g0513900_circ_g.5 Os01g0513900_circ_g.6 Os01g0513900_circ_g.7 Os01g0513900_circ_g.8 Os01g0513900_circ_g.9 Os01g0513900_circ_g.10 Os01g0513900_circ_g.11 Os01g0513900_circ_g.12 Os01g0513900_circ_g.13 Os01g0513900_circ_g.14 Os01g0513900_circ_g.15 Os01g0513900_circ_g.16 Os01g0513900_circ_g.17 Os01g0513900_circ_g.18 |
| Support reads | 18/2 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0513900-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_009638 |
| PMCS | 0.554198413 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
18152776-18152278(+) 18152288-18152223(+) 18152322-18152774(-) |
| Potential amino acid sequence |
MLREKAGFLLFSPDFKESAIY*(+) MGVSRPPSTPASKIERTPMSTPTPGGSTRVKEEKIFVTVRVRPLSKKELALKDQVAWECDDNQT ILYKGPPQDRAAPTSYTFDKVFGPASQTEVVYEEGAKDVAMSALTGINAS*(+) MQGCLEVLIHPFSLVNCRFLEVWGKQQEPSLLTKH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |