Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0513900_circ_g.5 |
ID in PlantcircBase | osa_circ_001928 |
Alias | Os_ciR623 |
Organism | Oryza sativa |
Position | chr1: 18152219-18152963 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
Parent gene | Os01g0513900 |
Parent gene annotation |
Similar to Kinesin heavy chain (Fragment). (Os01t0513900-01) |
Parent gene strand | + |
Alternative splicing | Os01g0513900_circ_g.1 Os01g0513900_circ_g.2 Os01g0513900_circ_g.3 Os01g0513900_circ_g.4 Os01g0513900_circ_g.6 Os01g0513900_circ_g.7 Os01g0513900_circ_g.8 Os01g0513900_circ_g.9 Os01g0513900_circ_g.10 Os01g0513900_circ_g.11 Os01g0513900_circ_g.12 Os01g0513900_circ_g.13 Os01g0513900_circ_g.14 Os01g0513900_circ_g.15 Os01g0513900_circ_g.16 Os01g0513900_circ_g.17 Os01g0513900_circ_g.18 |
Support reads | 50/6 |
Tissues | root/shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0513900-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_009639 |
PMCS | 0.68570664 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18152288-18152278(+) 18152322-18152322(-) |
Potential amino acid sequence |
MGVSRPPSTPASKIERTPMSTPTPGGSTRVKEEKIFVTVRVRPLSKKELALKDQVAWECDDNQT ILYKGPPQDRAAPTSYTFDKVFGPASQTEVVYEEGAKDVAMSALTGINATIFAYGQTSSGKTFT MRGVTESAVNDIYRHIENLREKAGFLLFSPDFKESAIY*(+) MQGCLEVLIHPFSLVNCRFLEVWGKQQEPSLLTKIFYVPVYIIYSTLCDASHGECLTTAGLTIG KNGGINACQCRHSNILSSLFIHHFCLGSWSKHLVESVRGGCSPILWGALVQNCLVIIALPCHLI LQGQFFLAQWSHPHCDKNLLLLDPSAATRGWGRHRCALNL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |