Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0318500_circ_g.13 |
| ID in PlantcircBase | osa_circ_036683 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr8: 13747310-13751987 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os08g0318500 |
| Parent gene annotation |
Sec8 exocyst complex component specific domain containing protei n. (Os08t0318500-01) |
| Parent gene strand | - |
| Alternative splicing | Os08g0318500_circ_g.1 Os08g0318500_circ_g.2 Os08g0318500_circ_g.3 Os08g0318500_circ_g.4 Os08g0318500_circ_g.5 Os08g0318500_circ_g.6 Os08g0318500_circ_g.7 Os08g0318500_circ_g.8 Os08g0318500_circ_g.9 Os08g0318500_circ_g.10 Os08g0318500_circ_g.11 Os08g0318500_circ_g.12 Os08g0318500_circ_g.14 Os08g0318500_circ_g.15 Os08g0318500_circ_g.16 Os08g0318500_circ_g.17 |
| Support reads | 1 |
| Tissues | pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0318500-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_017765 zma_circ_009512 zma_circ_002647 |
| PMCS | 0.108391611 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13747398-13751984(-) 13747340-13751984(-) |
| Potential amino acid sequence |
MPNYATELVEYVRTFLERTHERCRASYMEE*(-) MKDAVHPIWRNDGLLAFVNNFLKEHFLPAIFVDYRKCVQQAISSPAAFRPRVHATSVYSPLVEN GRPVLQGLLAVDIIAKEVLGWVQLMPNYATELVEYVRTFLERTHERCRASYMEE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |