Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0318500_circ_g.3 |
ID in PlantcircBase | osa_circ_036673 |
Alias | NA |
Organism | Oryza sativa |
Position | chr8: 13742268-13743141 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os08g0318500 |
Parent gene annotation |
Sec8 exocyst complex component specific domain containing protei n. (Os08t0318500-01) |
Parent gene strand | - |
Alternative splicing | Os08g0318500_circ_g.1 Os08g0318500_circ_g.2 Os08g0318500_circ_g.4 Os08g0318500_circ_g.5 Os08g0318500_circ_g.6 Os08g0318500_circ_g.7 Os08g0318500_circ_g.8 Os08g0318500_circ_g.9 Os08g0318500_circ_g.10 Os08g0318500_circ_g.11 Os08g0318500_circ_g.12 Os08g0318500_circ_g.13 Os08g0318500_circ_g.14 Os08g0318500_circ_g.15 Os08g0318500_circ_g.16 Os08g0318500_circ_g.17 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os08t0318500-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_007662* osi_circ_017761 |
PMCS | 0.274099828 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13743110-13742792(+) 13743129-13742313(+) 13743112-13743123(-) |
Potential amino acid sequence |
MVDELMNDSPSLYRCISSNARNPTKYIIPFRFCNIRSHFFIPTCDLSC*(+) MTLQAFIDALAATLEIPPNT*(+) MLENKNHIHQGRHTRSTSAIPKSLASLANEYRRLAIDCVRVLRLEMQLETIYHMQEMTKREYVE DQDAEDPDDFIISLTTQIARRDEEMAPYIAESKRNYVFGGISSVAANASIKAWRVIH*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |