Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d022502_circ_g.9 |
ID in PlantcircBase | zma_circ_009512 |
Alias | Zm07circ00101, zma_circ_0002604, GRMZM2G327394_C4 |
Organism | Zea mays |
Position | chr7: 179025330-179027705 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d022502 |
Parent gene annotation |
Exocyst complex component SEC8 |
Parent gene strand | + |
Alternative splicing | Zm00001d022502_circ_g.1 Zm00001d022502_circ_g.2 Zm00001d022502_circ_g.3 Zm00001d022502_circ_g.4 Zm00001d022502_circ_g.5 Zm00001d022502_circ_g.6 Zm00001d022502_circ_g.7 Zm00001d022502_circ_g.8 Zm00001d022502_circ_g.10 Zm00001d022502_circ_g.11 Zm00001d022502_circ_g.12 Zm00001d022502_circ_g.13 Zm00001d022502_circ_g.14 Zm00001d022502_circ_g.15 Zm00001d022502_circ_g.16 |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d022502_T006:3 Zm00001d022502_T004:3 Zm00001d022502_T017:3 Zm00001d022502_T008:3 Zm00001d022502_T010:3 Zm00001d022502_T001:3 Zm00001d022502_T018:3 Zm00001d022502_T014:3 Zm00001d022502_T009:3 Zm00001d022502_T012:3 Zm00001d022502_T002:3 Zm00001d022502_T013:3 Zm00001d022502_T007:3 Zm00001d022502_T016:2 Zm00001d022502_T019:3 Zm00001d022502_T003:3 Zm00001d022502_T015:3 Zm00001d022502_T005:3 Zm00001d022502_T011:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_036683 osa_circ_036681 osi_circ_017765 |
PMCS | 0.142802391 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
179027620-179025332(+) 179027678-179025332(+) |
Potential amino acid sequence |
MPNYATELVEYVRTFLERAHERCRASYMEE*(+) MRDVVHHIWRSDGLLAFVNNFLKEHFLPAIFVDYRKCVQQAISSPAAFRPRVHATSAYSSSVEL GRPVLQGLLAIDIIAKEVLGWVQLMPNYATELVEYVRTFLERAHERCRASYMEE*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |