Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0390400_circ_g.7 |
ID in PlantcircBase | osa_circ_001797 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 16490741-16492208 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0390400 |
Parent gene annotation |
Similar to Met-10+ like family protein. (Os01t0390400-01);Nuclei c acid-binding OB-fold domain containing protein. (Os01t0390400- 02);Nucleic acid-binding OB-fold domain containing protein. (Os0 1t0390400-03) |
Parent gene strand | + |
Alternative splicing | Os01g0391100_circ_igg.1 Os01g0388000_circ_g.1 EPlOSAG00000043644_circ_ig.1 EPlOSAG00000043644_circ_ig.2 Os01g0388500_circ_igg.1 Os01g0388500_circ_igg.2 Os01g0388500_circ_igg.3 Os01g0390300_circ_g.1 Os01g0390300_circ_g.2 Os01g0390300_circ_g.3 Os01g0390400_circ_g.1 Os01g0390400_circ_g.2 Os01g0390400_circ_g.3 Os01g0390400_circ_g.4 Os01g0390400_circ_g.5 Os01g0390400_circ_g.6 Os01g0390400_circ_g.8 Os01g0390900_circ_g.1 Os01g0390900_circ_g.2 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0390400-01:3 Os01t0390400-03:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_002069* |
PMCS | 0.32794231 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16492107-16491660(+) |
Potential amino acid sequence |
MDARRFISSIYSSQHVHPVTQVVMNLPNDAAEFLVIGILDYQQKDRGLLTMFSKILMLFVMCSL VLVQ*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |