Detailed infomation of each circRNA
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.257315498 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1119358-1119333(-) 1119334-1119384(+) |
| Potential amino acid sequence |
MKAQGLIHEVDAHSNLGNLMKAQGLIHEVDAHSNLGNLMKAQGLIHEVDAHSNLGNLMKAQGLI HE(-) MNQSLSLHQIPQITMCVNFMNQSLSLHQIPQITMCVNFMNQSLSLHQIPQITMCVNFMNQSLSL HQIPQITMCVN(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |