Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0288600_circ_g.7 |
ID in PlantcircBase | osa_circ_011155 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 11067779-11070603 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, circseq_cup |
Parent gene | Os12g0288600 |
Parent gene annotation |
Conserved hypothetical protein. (Os12t0288600-01) |
Parent gene strand | - |
Alternative splicing | Os12g0288600_circ_g.1 Os12g0288600_circ_g.2 Os12g0288600_circ_g.3 Os12g0288600_circ_g.4 Os12g0288600_circ_g.5 Os12g0288600_circ_g.6 Os12g0288600_circ_g.8 Os12g0288600_circ_g.9 |
Support reads | 2/2 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0288600-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_010417 zma_circ_003213 zma_circ_010303 |
PMCS | 0.098480348 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11067867-11070582(-) |
Potential amino acid sequence |
MKQMRKNLIHRMILFQLWLGLATFALSQQGQPNQVE*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2016;Chu et al., 2017 |