Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0288600_circ_g.7 |
| ID in PlantcircBase | osa_circ_011155 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 11067779-11070603 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, circseq_cup |
| Parent gene | Os12g0288600 |
| Parent gene annotation |
Conserved hypothetical protein. (Os12t0288600-01) |
| Parent gene strand | - |
| Alternative splicing | Os12g0288600_circ_g.1 Os12g0288600_circ_g.2 Os12g0288600_circ_g.3 Os12g0288600_circ_g.4 Os12g0288600_circ_g.5 Os12g0288600_circ_g.6 Os12g0288600_circ_g.8 Os12g0288600_circ_g.9 |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0288600-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_010417 zma_circ_003213 zma_circ_010303 |
| PMCS | 0.098480348 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11067867-11070582(-) |
| Potential amino acid sequence |
MKQMRKNLIHRMILFQLWLGLATFALSQQGQPNQVE*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2016;Chu et al., 2017 |