Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0592200_circ_g.2 |
ID in PlantcircBase | osa_circ_034613 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 24130749-24131323 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0592200 |
Parent gene annotation |
Aspartic protease, Pollen germination and pollen tube growth (Os 07t0592200-02);Similar to predicted protein. (Os07t0592200-03) |
Parent gene strand | - |
Alternative splicing | Os07g0592200_circ_g.3 Os07g0592200_circ_g.4 Os07g0592200_circ_g.5 Os07g0592200_circ_g.6 Os07g0592200_circ_g.7 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0592200-02:3 Os07t0592200-03:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_017291 |
PMCS | 0.178201507 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24130772-24131319(-) 24131296-24131319(-) |
Potential amino acid sequence |
MCSLYPREFDVGLITVDMSINVTYPNLKPHLHELAELIAKELDIDSRQVRVMNVTSQGNSTLIR WGIFPAGPSNSMTNTTAMGIIYRLTQHHVQLPENLGSYQLLEWNVQPLSKRI*(-) MSINVTYPNLKPHLHELAELIAKELDIDSRQVRVMNVTSQGNSTLIRWGIFPAGPSNSMTNTTA MGIIYRLTQHHVQLPENLGSYQLLEWNVQPLSKRI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |