Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0592200_circ_g.5 |
| ID in PlantcircBase | osa_circ_034616 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 24133811-24135330 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0592200 |
| Parent gene annotation |
Aspartic protease, Pollen germination and pollen tube growth (Os 07t0592200-02);Similar to predicted protein. (Os07t0592200-03) |
| Parent gene strand | - |
| Alternative splicing | Os07g0592200_circ_g.2 Os07g0592200_circ_g.3 Os07g0592200_circ_g.4 Os07g0592200_circ_g.6 Os07g0592200_circ_g.7 |
| Support reads | 3 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0592200-02:5 Os07t0592200-03:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_017292 |
| PMCS | 0.317129348 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
24135298-24133842(+) 24135218-24135313(-) |
| Potential amino acid sequence |
MYWRDQVGIVDPPNSVVGSFPF*(+) MSSSSGVLGEDIMSFGKESELKPQRAVFGCENTETGDLFSQHADGIMGLGRGQLSIMDQLVEKG VISDSFSLCYGGMDVGGGTMVLGGMPAPPDMVFSHSNPVRSPYYNIELKEIHVAGKALRLDPKI FNSKHGTVLDSGTTYAYLPEQAFVAFKDAVTNKVNSLKKIRGPDPNYKDICFAGAGRNVSQLSE VFPDVDMVFGNGQKLSLSPENYLFRHSKVEGAYCLGVFQNGKDPTTLLGGSTIPT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |