Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0592200_circ_g.3 |
ID in PlantcircBase | osa_circ_034614 |
Alias | Os_ciR4972 |
Organism | Oryza sativa |
Position | chr7: 24130749-24132815 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os07g0592200 |
Parent gene annotation |
Aspartic protease, Pollen germination and pollen tube growth (Os 07t0592200-02);Similar to predicted protein. (Os07t0592200-03) |
Parent gene strand | - |
Alternative splicing | Os07g0592200_circ_g.2 Os07g0592200_circ_g.4 Os07g0592200_circ_g.5 Os07g0592200_circ_g.6 Os07g0592200_circ_g.7 |
Support reads | 4 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0592200-03:4 Os07t0592200-02:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.113435998 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24130772-24132802(-) 24132674-24132802(-) |
Potential amino acid sequence |
MCSLYPRGIVVRNTLVTYDRHNEKIGFWKTNCSELWERLHISEVPSSAPSDSEGDMAPAPAPSG LPEFDVGLITVDMSINVTYPNLKPHLHELAELIAKELDIDSRQVRVMNVTSQGNSTLIRWGIFP AGPSNSMTNTTAMGIIYRLTQHHVQLPENLGSYQLLEWNVQPLSKRNCCP*(-) MAPAPAPSGLPEFDVGLITVDMSINVTYPNLKPHLHELAELIAKELDIDSRQVRVMNVTSQGNS TLIRWGIFPAGPSNSMTNTTAMGIIYRLTQHHVQLPENLGSYQLLEWNVQPLSKRNCCP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |