Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0567800_circ_g.1 |
ID in PlantcircBase | osa_circ_012032 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 23352683-23352766 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os12g0567800 |
Parent gene annotation |
Plant metallothionein, family 15 protein. (Os12t0567800-01) |
Parent gene strand | - |
Alternative splicing | Os12g0567800_circ_ag.1 Os12g0567800_circ_g.2 Os12g0567800_circ_g.3 Os12g0567800_circ_g.4 Os12g0567800_circ_g.5 Os12g0567800_circ_ag.6 Os12g0567800_circ_ag.7 Os12g0567800_circ_igg.1 Os12g0567800_circ_ag.2 Os12g0567800_circ_ag.3 Os12g0568100_circ_ig.1 Os12g0568200_circ_igg.1 Os12g0568500_circ_igg.1 Os12g0568166_circ_g.1 Os12g0568200_circ_ag.1 Os12g0568200_circ_ag.2 Os12g0568350_circ_g.1 Os12g0568350_circ_g.2 Os12g0568350_circ_g.3 Os12g0568350_circ_g.4 Os12g0568350_circ_g.5 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0567800-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.197420933 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
23352732-23352763(+) |
Potential amino acid sequence |
MVIFSARSGYIFPFSGATPRTVVVVVVVMVIFSARSGYIFPFSGATPRTVVVVVVVMVIFSARS GYIFPFSGATPRTVVVVVVVMVIFSARSGYIF(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |