Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d022502_circ_g.16 |
ID in PlantcircBase | zma_circ_009516 |
Alias | Zm07circ00103, GRMZM2G327394_C1 |
Organism | Zea mays |
Position | chr7: 179030437-179031536 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d022502 |
Parent gene annotation |
Exocyst complex component SEC8 |
Parent gene strand | + |
Alternative splicing | Zm00001d022502_circ_g.1 Zm00001d022502_circ_g.2 Zm00001d022502_circ_g.3 Zm00001d022502_circ_g.4 Zm00001d022502_circ_g.5 Zm00001d022502_circ_g.6 Zm00001d022502_circ_g.7 Zm00001d022502_circ_g.8 Zm00001d022502_circ_g.9 Zm00001d022502_circ_g.10 Zm00001d022502_circ_g.11 Zm00001d022502_circ_g.12 Zm00001d022502_circ_g.13 Zm00001d022502_circ_g.14 Zm00001d022502_circ_g.15 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d022502_T013:2 Zm00001d022502_T003:2 Zm00001d022502_T005:2 Zm00001d022502_T009:2 Zm00001d022502_T001:2 Zm00001d022502_T012:2 Zm00001d022502_T016:3 Zm00001d022502_T010:2 Zm00001d022502_T014:1 Zm00001d022502_T007:2 Zm00001d022502_T018:2 Zm00001d022502_T011:2 Zm00001d022502_T004:2 Zm00001d022502_T015:2 Zm00001d022502_T008:2 Zm00001d022502_T006:2 Zm00001d022502_T002:2 Zm00001d022502_T019:2 Zm00001d022502_T017:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.21349721 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
179030495-179030491(+) |
Potential amino acid sequence |
MRLEPANISLQNSTGEHDNNATGAEAVEVEIELSDLLLDMCPIKQENLIHDDQKLILLASLSDS LEYLADSVERLSLKSKVIFSFQGMTLRV*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |