Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0304200_circ_g.3 |
ID in PlantcircBase | osa_circ_023355 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 13642299-13643001 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0304200 |
Parent gene annotation |
Similar to Nonphototropic hypocotyl protein 1 (EC 2.7.1.37) (Pho totropin). (Os04t0304200-01) |
Parent gene strand | - |
Alternative splicing | Os04g0304200_circ_g.2 Os04g0304200_circ_g.4 Os04g0304200_circ_g.5 Os04g0304200_circ_g.6 Os04g0304200_circ_g.7 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0304200-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_005372* |
PMCS | 0.266279256 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13642937-13642500(+) |
Potential amino acid sequence |
MSFSCSFLGKVYAHTASHTIEFLKMYQDLGEHLHQASLLVEFPCQLVSEEHLVQGGSCNV*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |