Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0443700_circ_g.7 |
ID in PlantcircBase | osa_circ_011417 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 14902819-14903497 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os12g0443700 |
Parent gene annotation |
Similar to Glu-prolyl-tRNA aminoacyl synthetase (Fragment). (Os1 2t0443700-01);Similar to Glu-prolyl-tRNA aminoacyl synthetase (F ragment). (Os12t0443700-02);Similar to Aminoacyl-tRNA synthase. (Os12t0443700-03) |
Parent gene strand | - |
Alternative splicing | Os12g0443700_circ_g.1 Os12g0443700_circ_g.2 Os12g0443700_circ_g.3 Os12g0443700_circ_g.4 Os12g0443700_circ_g.5 Os12g0443700_circ_g.6 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0443700-02:2 Os12t0443700-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.14702948 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14903481-14902821(-) 14902867-14903478(-) |
Potential amino acid sequence |
MIEYYDISGCYILRPWAMEIWELLKEFFDAEIKKLKLKPYYFPLFVTENVLQKEKDHIEGFAPE VVVNSEMIEYYDISGCYILRPWAMEIWELLKEFFDAEIKKLKLKPYYFPLFVTENVLQKEKDHI EGFAPEVVVNSEMIEYYDISGCYILRPWAMEIWELLKEFFDAEIKKLKLKPYYFPLFVTENVLQ KEKDHIEGFAPEVVVNSEMIEYYDISGCYILRPWAMEIWELLKEFFDAEIKKLKLKPYYFPLFV TENVLQKEKDHIEGFAPE(-) MSYRRRKTTLRALHQRLSLTVK*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |