Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0443700_circ_g.7 |
| ID in PlantcircBase | osa_circ_011417 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 14902819-14903497 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0443700 |
| Parent gene annotation |
Similar to Glu-prolyl-tRNA aminoacyl synthetase (Fragment). (Os1 2t0443700-01);Similar to Glu-prolyl-tRNA aminoacyl synthetase (F ragment). (Os12t0443700-02);Similar to Aminoacyl-tRNA synthase. (Os12t0443700-03) |
| Parent gene strand | - |
| Alternative splicing | Os12g0443700_circ_g.1 Os12g0443700_circ_g.2 Os12g0443700_circ_g.3 Os12g0443700_circ_g.4 Os12g0443700_circ_g.5 Os12g0443700_circ_g.6 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0443700-02:2 Os12t0443700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.14702948 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14903481-14902821(-) 14902867-14903478(-) |
| Potential amino acid sequence |
MIEYYDISGCYILRPWAMEIWELLKEFFDAEIKKLKLKPYYFPLFVTENVLQKEKDHIEGFAPE VVVNSEMIEYYDISGCYILRPWAMEIWELLKEFFDAEIKKLKLKPYYFPLFVTENVLQKEKDHI EGFAPEVVVNSEMIEYYDISGCYILRPWAMEIWELLKEFFDAEIKKLKLKPYYFPLFVTENVLQ KEKDHIEGFAPEVVVNSEMIEYYDISGCYILRPWAMEIWELLKEFFDAEIKKLKLKPYYFPLFV TENVLQKEKDHIEGFAPE(-) MSYRRRKTTLRALHQRLSLTVK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |