Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0262300_circ_g.6 |
| ID in PlantcircBase | osa_circ_018981 |
| Alias | Os_ciR5398 |
| Organism | Oryza sativa |
| Position | chr3: 8588433-8592747 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os03g0262300 |
| Parent gene annotation |
Hypothetical conserved gene. (Os03t0262300-01) |
| Parent gene strand | - |
| Alternative splicing | Os03g0262300_circ_g.3 Os03g0262300_circ_g.4 Os03g0262300_circ_g.5 Os03g0262300_circ_g.7 Os03g0262300_circ_g.8 Os03g0262300_circ_g.9 Os03g0262300_circ_g.10 |
| Support reads | 3/2 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0262300-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_014165 |
| PMCS | 0.09700298 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8588437-8588434(-) |
| Potential amino acid sequence |
MIDVDDECLLASSSCFHASLFESKQHERVQHELPEVTPKGCQTANLWTDKYRPETAAQVCGNSK HVKFLNEWLKGWDERGHRNKQNIVTNGSMNGRSCQDGSDTDYSEDASDYENVLLITGPVGCGKS AAVFACAREQGFNVIEVNTSDMRNGAYVRQKFEEATKSHGLEK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |