Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0262300_circ_g.7 |
ID in PlantcircBase | osa_circ_018982 |
Alias | Os_ciR9199 |
Organism | Oryza sativa |
Position | chr3: 8588433-8594774 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os03g0262300 |
Parent gene annotation |
Hypothetical conserved gene. (Os03t0262300-01) |
Parent gene strand | - |
Alternative splicing | Os03g0262300_circ_g.3 Os03g0262300_circ_g.4 Os03g0262300_circ_g.5 Os03g0262300_circ_g.6 Os03g0262300_circ_g.8 Os03g0262300_circ_g.9 Os03g0262300_circ_g.10 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0262300-01:9 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.093151664 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8594686-8588483(+) 8594222-8588454(+) 8588437-8594717(-) |
Potential amino acid sequence |
MLCSAFGSEPSVLHPDSYPCLSSVFSEGFHHFSRPCDLVASSNFCLT*(+) MTISRFQCFAVLSVRNLQCCTLILTPAFPLFFLRAFIIFLDHVI*(+) MMKALRKNRGKAGVRIRVQH*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |