Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0252200_circ_g.3 |
| ID in PlantcircBase | osa_circ_023188 |
| Alias | Os04circ01744/Os_ciR726 |
| Organism | Oryza sativa |
| Position | chr4: 9898548-9900259 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, CIRI, KNIFE, PcircRNA_finder, SMALT, Segemehl, circRNA_finder, find_circ |
| Parent gene | Os04g0252200 |
| Parent gene annotation |
Similar to CPSF160; nucleic acid binding. (Os04t0252200-01);Simi lar to CPSF160; nucleic acid binding. (Os04t0252200-02) |
| Parent gene strand | - |
| Alternative splicing | Os04g0252200_circ_g.1 Os04g0252200_circ_g.2 Os04g0252200_circ_g.4 Os04g0252200_circ_g.5 Os04g0252200_circ_g.6 Os04g0252200_circ_g.7 Os04g0252200_circ_g.8 Os04g0252200_circ_g.9 Os04g0252200_circ_g.10 Os04g0252200_circ_g.11 Os04g0252200_circ_g.12 Os04g0252200_circ_g.13 Os04g0252200_circ_g.14 Os04g0252200_circ_g.15 Os04g0252200_circ_g.16 Os04g0252200_circ_g.17 Os04g0252200_circ_g.18 |
| Support reads | 7/39/5 |
| Tissues | leaf and panicle/root/shoot, root, seed, pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0252200-02:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_005337* osi_circ_015133 |
| PMCS | 0.383567197 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9900237-9898622(+) 9899508-9899526(-) |
| Potential amino acid sequence |
MWGAMQRDNVQAHNMQRGIIECNSSQFSTSPLV*(+) MADQESVHHMDNDVTSTDALHKTYTVDEFEVRILELEKPGGHWETKSTIPMQLFENALTVRIVT LHNTTTKENETLLAIGTAYVLGEDVAARGRVLLFSFTKSENSQNLVTEVYSKESKGAVSAVASL QGHLLIASGPKITLNKWTGAELTAVAFYDAPLHVVSLNIVPLHGTPHQVTYYAEQSLYPLIVSV PFVP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2015;Chu et al., 2017 |