Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0252200_circ_g.12 |
| ID in PlantcircBase | osa_circ_023197 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 9905861-9913088 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0252200 |
| Parent gene annotation |
Similar to CPSF160; nucleic acid binding. (Os04t0252200-01);Simi lar to CPSF160; nucleic acid binding. (Os04t0252200-02) |
| Parent gene strand | - |
| Alternative splicing | Os04g0252200_circ_g.1 Os04g0252200_circ_g.2 Os04g0252200_circ_g.3 Os04g0252200_circ_g.4 Os04g0252200_circ_g.5 Os04g0252200_circ_g.6 Os04g0252200_circ_g.7 Os04g0252200_circ_g.8 Os04g0252200_circ_g.9 Os04g0252200_circ_g.10 Os04g0252200_circ_g.11 Os04g0252200_circ_g.13 Os04g0252200_circ_g.14 Os04g0252200_circ_g.15 Os04g0252200_circ_g.16 Os04g0252200_circ_g.17 Os04g0252200_circ_g.18 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0252200-01:9 Os04t0252200-02:10 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.201268853 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9913058-9905897(+) 9908175-9913004(-) |
| Potential amino acid sequence |
MKYDQHRLNITIVRFSRLIIRYA*(+) MGNAKQSNYELVCCSGHGKNGSLSVLQQSIRPDLITEVELPSCRGIWTVYYKSYRGQMAEDNEY HAYLIISLENRTMVILSLCWSYFMSKSLHGLGVSYQSTIHA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |