Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0262300_circ_g.4 |
ID in PlantcircBase | osa_circ_018980 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 8586730-8591431 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0262300 |
Parent gene annotation |
Hypothetical conserved gene. (Os03t0262300-01) |
Parent gene strand | - |
Alternative splicing | Os03g0262300_circ_g.3 Os03g0262300_circ_g.5 Os03g0262300_circ_g.6 Os03g0262300_circ_g.7 Os03g0262300_circ_g.8 Os03g0262300_circ_g.9 Os03g0262300_circ_g.10 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0262300-01:7 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.096660524 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8591081-8591159(-) |
Potential amino acid sequence |
MNGRSCQDGSDTDYSEDASDYENVLLITGPVGCGKSAAVFACAREQGFNVIEVNTSDMRNGAYV RQKFEEATKSHGLEKWSQEEIIGLPISNSLDPASGTPGTAEYKQVINKTLILFEDVDTVFDEDR GFISTILKMVETTKWPIILTSNKKDPPLPHLLAQLVLDFTYPSSAELLSHVDMICKSEGVEITV PQQKHIIDAFLGDIRRTMMLLQFWYQGKQQYSAVRQLTYGLTSTGLKLLHRFVVIPSM*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |