Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d046579_circ_g.7 |
| ID in PlantcircBase | zma_circ_009986 |
| Alias | Zm09circ00048 |
| Organism | Zea mays |
| Position | chr9: 96781626-96797627 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | ue-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d046579 |
| Parent gene annotation |
Transcription initiation factor TFIID subunit 1 |
| Parent gene strand | + |
| Alternative splicing | Zm00001d046579_circ_g.1 Zm00001d046579_circ_g.2 Zm00001d046579_circ_g.3 Zm00001d046579_circ_g.4 Zm00001d046579_circ_g.5 Zm00001d046579_circ_g.6 Zm00001d046579_circ_g.8 Zm00001d046579_circ_g.9 Zm00001d046579_circ_g.10 Zm00001d046579_circ_g.11 Zm00001d046579_circ_g.12 Zm00001d046579_circ_g.13 Zm00001d046579_circ_g.14 |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Zm00001d046579_T024:13 Zm00001d046579_T020:13 Zm00001d046579_T009:13 Zm00001d046579_T011:13 Zm00001d046579_T031:5 Zm00001d046579_T030:5 Zm00001d046579_T029:7 Zm00001d046579_T001:13 Zm00001d046579_T002:12 Zm00001d046579_T005:13 Zm00001d046579_T027:7 Zm00001d046579_T015:13 Zm00001d046579_T008:12 Zm00001d046579_T003:13 Zm00001d046579_T026:3 Zm00001d046579_T006:13 Zm00001d046579_T023:13 Zm00001d046579_T016:13 Zm00001d046579_T025:12 Zm00001d046579_T018:13 Zm00001d046579_T007:13 Zm00001d046579_T004:12 Zm00001d046579_T019:13 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.127648243 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
96797531-96781626(+) 96793967-96781697(+) |
| Potential amino acid sequence |
MRLLSLLLHHISRGNCKSLAGILQVISSLVLIR*(+) MQNVRPNSIVHAVRTEVYLWPKAQKLPGEDKPLRPPGAFRKKTDLSIKDGHVFLMEYCEERPLL LSNAGMGARLCTYYQKTTPTDQTAASLRNNSDGLGTVLAIDPADKSPFLGEIHSGSHQSCLETN MYRSPVFPHKVAPTDYLLVRSAKGALSLRRIDKLYVVGQQEPHMEVFSPGTKNMQNYLLNRVLA YVYREFRARERPDAIPQIRADELPIQSPLTEAIVKKRLKHCADLKKGPKGHFFWTQRPDFRVPS EEELRRLLTPESVCCYESMQAGLYRLKRLGILKLTQPVGLASAMNQLPDEAIELAAASHIEREL QITSWNLTSNFVACTNQMTMTTRIMRSLVEEITYWGLCSAM*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Han et al., 2020 |