Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d046579_circ_g.12 |
ID in PlantcircBase | zma_circ_009991 |
Alias | zma_circ_0003266, ZmciR411 |
Organism | Zea mays |
Position | chr9: 96793895-96796581 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d046579 |
Parent gene annotation |
Transcription initiation factor TFIID subunit 1 |
Parent gene strand | + |
Alternative splicing | Zm00001d046579_circ_g.1 Zm00001d046579_circ_g.2 Zm00001d046579_circ_g.3 Zm00001d046579_circ_g.4 Zm00001d046579_circ_g.5 Zm00001d046579_circ_g.6 Zm00001d046579_circ_g.7 Zm00001d046579_circ_g.8 Zm00001d046579_circ_g.9 Zm00001d046579_circ_g.10 Zm00001d046579_circ_g.11 Zm00001d046579_circ_g.13 Zm00001d046579_circ_g.14 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d046579_T031:4 Zm00001d046579_T011:4 Zm00001d046579_T008:4 Zm00001d046579_T007:4 Zm00001d046579_T018:4 Zm00001d046579_T016:4 Zm00001d046579_T015:4 Zm00001d046579_T020:4 Zm00001d046579_T030:4 Zm00001d046579_T025:4 Zm00001d046579_T005:4 Zm00001d046579_T002:4 Zm00001d046579_T009:4 Zm00001d046579_T023:4 Zm00001d046579_T003:4 Zm00001d046579_T006:4 Zm00001d046579_T027:4 Zm00001d046579_T004:4 Zm00001d046579_T024:4 Zm00001d046579_T029:4 Zm00001d046579_T001:4 Zm00001d046579_T019:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.158903767 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
96793967-96793897(+) |
Potential amino acid sequence |
MQNVRPNSIVHAVRTEVYLWPKAQKLPGEDKPLRPPGAFRKKTDLSIKDGHVFLMEYCEERPLL LSNAGMGARLCTYYQKTTPTDQTAASLRNNSDGLGTVLAIDPADKSPFLGEIHSGSHQSCLETN MYRSPVFPHKVAPTDYLLVRSAKGALSLRRIDKLYVVGQQEPHMEVFSPGTKNMQNYLLNRVLA YVYREFRARERPDAIPQIRADELPIQSPLTEAIVKKRLKHCADLKKGPKGHFFWTQRPDFRVPS EEELRRLLTPESN*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |