Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0160000_circ_g.4 |
| ID in PlantcircBase | osa_circ_006257 |
| Alias | Os_ciR6952 |
| Organism | Oryza sativa |
| Position | chr10: 3833594-3834089 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os10g0160000 |
| Parent gene annotation |
Similar to Ubiquitin carboxyl-terminal hydrolase 12 (EC 3.1.2.15 ) (Ubiquitin thiolesterase 12) (Ubiquitin-specific processing pr otease 12) (Deubiquitinating enzyme 12). (Os10t0160000-01);Simil ar to Ubiquitin carboxyl-terminal hydrolase. (Os10t0160000-02) |
| Parent gene strand | - |
| Alternative splicing | Os10g0160000_circ_g.1 Os10g0160000_circ_g.2 Os10g0160000_circ_g.3 Os10g0160000_circ_g.5 Os10g0160000_circ_g.6 Os10g0160000_circ_g.7 Os10g0160000_circ_g.8 |
| Support reads | 2/1 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0160000-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_002744* |
| PMCS | 0.391706468 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3834025-3833983(-) |
| Potential amino acid sequence |
MYLSLPLPSTVTRMINVTVFSGTGDALPMPYTVKVQKNGVCGDLIKSLSVMCCLQSCETLLLAE VYDHRIYRYWNPSEPLCHVKDEDKLVAYRLPVGSENLLRVEILHRVVDRVSTSPLWFAQIVRKS QLHLTHSCTCHCHCPQQLLA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |