Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d024327_circ_g.8 |
ID in PlantcircBase | zma_circ_010209 |
Alias | zma_circ_0000156, ZmciR453 |
Organism | Zea mays |
Position | chr10: 64848357-64849579 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI2 |
Parent gene | Zm00001d024327 |
Parent gene annotation |
RING/FYVE/PHD zinc finger superfamily protein |
Parent gene strand | - |
Alternative splicing | Zm00001d024327_circ_g.6 Zm00001d024327_circ_g.7 Zm00001d024327_circ_g.9 Zm00001d024327_circ_g.10 Zm00001d024327_circ_g.11 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d024327_T001:3 Zm00001d024327_T002:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.165322563 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
64849519-64848663(+) 64849578-64849571(-) |
Potential amino acid sequence |
MADRSSTRSSTQSAAAFLYIFLLKTIRLWRQRIIIFYQLKKKLSRTRNEIFQFNAIFSNSFLCS SFSSALKTNHHTFFFC*(+) MYRKAAALWVELRVELLSAIEYYAEDKVNSAQIWRLYWASHQRFFRHMCMSAKVPAVVRLAKEA LAEEKCVVIGLQSTGEARTEEAVAKYGIELEDFVSGPRELLLKLVEDNYPLPPKPDCFEQEYV* (-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Ma et al., 2021b;Zhang et al., 2019 |