Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d024327_circ_g.10 |
ID in PlantcircBase | zma_circ_010210 |
Alias | Zm10circ00024, zma_circ_0003179, GRMZM2G339545_C3 |
Organism | Zea mays |
Position | chr10: 64861443-64861808 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d024327 |
Parent gene annotation |
RING/FYVE/PHD zinc finger superfamily protein |
Parent gene strand | - |
Alternative splicing | Zm00001d024327_circ_g.6 Zm00001d024327_circ_g.7 Zm00001d024327_circ_g.8 Zm00001d024327_circ_g.9 Zm00001d024327_circ_g.11 |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d024327_T001:2 Zm00001d024327_T002:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.170850997 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
64861758-64861483(+) 64861766-64861757(-) |
Potential amino acid sequence |
MSIATSSRAPTPPFSRAPSFFPPEVILGYQS*(+) MDMKARGMYVCRTLSYKGANFDILESLLEERMMVLLRKEVWVLLNLLLWT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |