Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d024327_circ_g.10 |
| ID in PlantcircBase | zma_circ_010210 |
| Alias | Zm10circ00024, zma_circ_0003179, GRMZM2G339545_C3 |
| Organism | Zea mays |
| Position | chr10: 64861443-64861808 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | CIRI2, find_circ |
| Parent gene | Zm00001d024327 |
| Parent gene annotation |
RING/FYVE/PHD zinc finger superfamily protein |
| Parent gene strand | - |
| Alternative splicing | Zm00001d024327_circ_g.6 Zm00001d024327_circ_g.7 Zm00001d024327_circ_g.8 Zm00001d024327_circ_g.9 Zm00001d024327_circ_g.11 |
| Support reads | NA |
| Tissues | leaf, endosperm, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d024327_T001:2 Zm00001d024327_T002:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.170850997 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
64861758-64861483(+) 64861766-64861757(-) |
| Potential amino acid sequence |
MSIATSSRAPTPPFSRAPSFFPPEVILGYQS*(+) MDMKARGMYVCRTLSYKGANFDILESLLEERMMVLLRKEVWVLLNLLLWT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |