Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d024327_circ_g.8 |
| ID in PlantcircBase | zma_circ_010209 |
| Alias | zma_circ_0000156, ZmciR453 |
| Organism | Zea mays |
| Position | chr10: 64848357-64849579 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | find_circ, CIRI2 |
| Parent gene | Zm00001d024327 |
| Parent gene annotation |
RING/FYVE/PHD zinc finger superfamily protein |
| Parent gene strand | - |
| Alternative splicing | Zm00001d024327_circ_g.6 Zm00001d024327_circ_g.7 Zm00001d024327_circ_g.9 Zm00001d024327_circ_g.10 Zm00001d024327_circ_g.11 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d024327_T001:3 Zm00001d024327_T002:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.165322563 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
64849519-64848663(+) 64849578-64849571(-) |
| Potential amino acid sequence |
MADRSSTRSSTQSAAAFLYIFLLKTIRLWRQRIIIFYQLKKKLSRTRNEIFQFNAIFSNSFLCS SFSSALKTNHHTFFFC*(+) MYRKAAALWVELRVELLSAIEYYAEDKVNSAQIWRLYWASHQRFFRHMCMSAKVPAVVRLAKEA LAEEKCVVIGLQSTGEARTEEAVAKYGIELEDFVSGPRELLLKLVEDNYPLPPKPDCFEQEYV* (-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Ma et al., 2021b;Zhang et al., 2019 |