Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G14160_circ_g.14 |
| ID in PlantcircBase | ath_circ_030854 |
| Alias | At_ciR4003 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 8171829-8171990 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder, find_circ, CIRI-full |
| Parent gene | AT4G14160 |
| Parent gene annotation |
Sec23/Sec24 protein transport family protein |
| Parent gene strand | + |
| Alternative splicing | AT4G14160_circ_g.2 AT4G14160_circ_g.3 AT4G14160_circ_g.4 AT4G14160_circ_g.5 AT4G14160_circ_g.6 AT4G14160_circ_g.7 AT4G14160_circ_g.8 AT4G14160_circ_g.9 AT4G14160_circ_g.10 AT4G14160_circ_g.11 AT4G14160_circ_g.12 AT4G14160_circ_g.13 AT4G14160_circ_g.15 AT4G14160_circ_g.16 |
| Support reads | 6/1 |
| Tissues | leaf/whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G14160.1:1 AT4G14160.3:1 AT4G14160.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.201649998 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8171958-8171987(+) |
| Potential amino acid sequence |
MFNLRRSQFVQEGFDATRWLDRTLIRLCSKFGEYRKDDPTSFTLKPYLTLFPQFMFNLRRSQFV QEGFDATRWLDRTLIRLCSKFGEYRKDDPTSFTLKPYLTLFPQFMFNLRRSQFVQEGFDATRWL DRTLIRLCSKFGEYRKDDPTSFTLKPYLTLFPQFMFNLRRSQFVQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |