Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G14160_circ_g.14 |
ID in PlantcircBase | ath_circ_030854 |
Alias | At_ciR4003 |
Organism | Arabidpsis thaliana |
Position | chr4: 8171829-8171990 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder, find_circ, CIRI-full |
Parent gene | AT4G14160 |
Parent gene annotation |
Sec23/Sec24 protein transport family protein |
Parent gene strand | + |
Alternative splicing | AT4G14160_circ_g.2 AT4G14160_circ_g.3 AT4G14160_circ_g.4 AT4G14160_circ_g.5 AT4G14160_circ_g.6 AT4G14160_circ_g.7 AT4G14160_circ_g.8 AT4G14160_circ_g.9 AT4G14160_circ_g.10 AT4G14160_circ_g.11 AT4G14160_circ_g.12 AT4G14160_circ_g.13 AT4G14160_circ_g.15 AT4G14160_circ_g.16 |
Support reads | 6/1 |
Tissues | leaf/whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT4G14160.1:1 AT4G14160.3:1 AT4G14160.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.201649998 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8171958-8171987(+) |
Potential amino acid sequence |
MFNLRRSQFVQEGFDATRWLDRTLIRLCSKFGEYRKDDPTSFTLKPYLTLFPQFMFNLRRSQFV QEGFDATRWLDRTLIRLCSKFGEYRKDDPTSFTLKPYLTLFPQFMFNLRRSQFVQEGFDATRWL DRTLIRLCSKFGEYRKDDPTSFTLKPYLTLFPQFMFNLRRSQFVQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |